PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2225_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 166aa    MW: 18868.1 Da    PI: 8.5821
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2225_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.61.5e-4265142178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +C ve+C adl++a++yh+rhkvCe+hskapvv+v+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  Neem_2225_f_2  65 CCVVEKCGADLTDARRYHKRHKVCEIHSKAPVVIVAGLRQRFCQQCSRFHELSEFDESKRSCRRRLAGHNERRRKSTA 142
                    6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-3460127IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.50563140IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-3964144IPR004333Transcription factor, SBP-box
PfamPF031102.6E-3266139IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MDAASLEAKR LLKEKTIKEC FVEDDMDNEM EEEEEGGGDN YADDEKKKRV SGRRGPGAGG  60
VSTPCCVVEK CGADLTDARR YHKRHKVCEI HSKAPVVIVA GLRQRFCQQC SRFHELSEFD  120
ESKRSCRRRL AGHNERRRKS TAETTGESRQ QLSLQGNSSY RRSQTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-3558139384squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451806.12e-67hypothetical protein CICLE_v10009879mg
RefseqXP_006464784.12e-67PREDICTED: squamosa promoter-binding-like protein 13
SwissprotQ387402e-45SBP2_ANTMA; Squamosa promoter-binding protein 2
SwissprotQ387411e-45SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A067FH623e-67A0A067FH62_CITSI; Uncharacterized protein
TrEMBLV4URD23e-67V4URD2_9R
STRINGPOPTR_0001s40870.15e-61(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.29e-42squamosa promoter binding protein-like 4