PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21486_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 214aa    MW: 22723.8 Da    PI: 5.1864
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21486_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.6e-43501491100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la
  Neem_21486_f_1  50 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQLA 144
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++ 
  Neem_21486_f_1 145 KAQAD 149
                     99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.22849150IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-4350147IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MENYEVAGAT TATAANSTIT NSTAGSSSPP PSSSSPNSAP NPPPPVVISP CAACKILRRR  60
CADKCVLAPY FPPTEPAKFT IAHRVFGASN IIKFLQELPE SQRADAVSSM VYEASARIRD  120
PVYGCAGAIC QLQKQVNELQ AQLAKAQADL VNMQCQQANL AALLCMEMSK SPQPNSPESV  180
DNFIITSPGS PQQGNPSCFL DDNNLSGPLW PLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488170.11e-112PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A067G4031e-112A0A067G403_CITSI; Uncharacterized protein
STRINGGLYMA11G15810.17e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-61LOB domain-containing protein 1