PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2079_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 470aa    MW: 51442.8 Da    PI: 8.3057
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2079_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.8e-32191247360
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  ++++ ei+Y+geHnh+k
  Neem_2079_f_1 191 DGYNWRKYGQKQVKGSEYPRSYYKCTHPSCPVKKKVERSF-EGNIAEIVYKGEHNHPK 247
                    9***************************************.***************85 PP

2WRKY1062e-33388446159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    l+Dg++WrKYGqK+vkg+++prsYYrCt  +C+v+k+ver+++dp+++++tYeg+Hnhe
  Neem_2079_f_1 388 LNDGFRWRKYGQKVVKGNPYPRSYYRCTNLKCKVRKHVERASDDPTAFITTYEGKHNHE 446
                    58********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.3E-29186248IPR003657WRKY domain
SuperFamilySSF1182906.8E-26187248IPR003657WRKY domain
SMARTSM007748.2E-36189247IPR003657WRKY domain
PfamPF031066.6E-25191246IPR003657WRKY domain
PROSITE profilePS5081123.697191248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.7E-35373448IPR003657WRKY domain
SuperFamilySSF1182908.24E-29382448IPR003657WRKY domain
PROSITE profilePS5081134.429383448IPR003657WRKY domain
SMARTSM007741.1E-39388447IPR003657WRKY domain
PfamPF031061.8E-26389446IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MEMKEAERIV VAKPVPSRPT CSTFGPFSEL LAGAINASPP NGCSETAVVA IKPKTVRFKP  60
LVNHAPPNQA ELSRTAVCNS SDDVSKSDSK PPVIYKPQAK LVSKTTVSLL ANMGNFNSSH  120
QHTQQSTESH AQNPGQDKNN FRSQTSSNGN LIMPAHKENN QAIESSKIAS QNMEEDPKSL  180
IAAAGDRPSY DGYNWRKYGQ KQVKGSEYPR SYYKCTHPSC PVKKKVERSF EGNIAEIVYK  240
GEHNHPKPQP AKRSSSGTQG PGLVSDGTAQ DINNPLWNNH PNEKTEGAEG RVESQNEVGL  300
LANSTGKAPL PYDPASTGVN NAGTATSDNS CGISGECDEG RKGPEVEDYE PSNKRRKSEN  360
QSNEAGMSEE AMQEPRVVVQ SSTDSEILND GFRWRKYGQK VVKGNPYPRS YYRCTNLKCK  420
VRKHVERASD DPTAFITTYE GKHNHEMPLR NTNPLTSEHD SLAPTSSDKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-32191448877Probable WRKY transcription factor 4
2lex_A4e-32191448877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428919.10.0WRKY transcription factor 44 isoform X1
RefseqXP_024038132.10.0WRKY transcription factor 44 isoform X1
RefseqXP_024038133.10.0WRKY transcription factor 44 isoform X1
TrEMBLA0A411PZL30.0A0A411PZL3_9ROSI; WRKY family transcription factor
STRINGXP_006428919.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-113WRKY family protein