PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2071_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 1707aa    MW: 193609 Da    PI: 7.2596
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2071_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY84.97.3e-2714041460359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY    3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59  
                     Dgy+WrKYGqK++ gs+fprsY+rC+++ Cp++k+v++ ++dp ++e+t+ g H+++
  Neem_2071_f_3 1404 DGYTWRKYGQKDIMGSKFPRSYFRCAHRPCPATKQVQQLDDDPAIFEVTFLGMHTCP 1460
                     9******************************************************97 PP

2WRKY77.61.4e-2415271586258
                     --SS-EEEEEEE--TT-SS-EEEEEE-ST...T---EEEEEE-SSSTTEEEEEEES--SS CS
           WRKY    2 dDgynWrKYGqKevkgsefprsYYrCtsa...gCpvkkkversaedpkvveitYegeHnh 58  
                      Dgy+WrKYGqK++ gs+fpr YY Ct++   +C++kk+v++ ++dp  +e+tY g H++
  Neem_2071_f_3 1527 VDGYTWRKYGQKDIMGSKFPRIYYICTHStlyNCSAKKRVQQLNDDPASFEVTYVGMHKC 1586
                     5***************************9999**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF525401.01E-44129382IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3002.9E-18135271IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009318.3E-47135401IPR002182NB-ARC
SMARTSM003820.0029147282IPR003593AAA+ ATPase domain
PRINTSPR003646.5E-18150165No hitNo description
CDDcd019830.00732150186No hitNo description
PRINTSPR003646.5E-18222236No hitNo description
PRINTSPR003646.5E-18315329No hitNo description
SuperFamilySSF520587.48E-27443843IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.101.4E-19485752IPR032675Leucine-rich repeat domain, L domain-like
PfamPF138554.6E-8572629IPR001611Leucine-rich repeat
PRINTSPR003646.5E-18591607No hitNo description
Gene3DG3DSA:3.80.10.106.1E-11753844IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520471.26E-9777884No hitNo description
SuperFamilySSF520471.26E-99281044No hitNo description
Gene3DG3DSA:3.80.10.106.1E-11948971IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520479.42E-1110731259No hitNo description
Gene3DG3DSA:3.80.10.106.1E-1110761252IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:2.20.25.802.5E-2513911461IPR003657WRKY domain
PROSITE profilePS5081120.67913971462IPR003657WRKY domain
SuperFamilySSF1182901.44E-2414001461IPR003657WRKY domain
SMARTSM007741.1E-3414021461IPR003657WRKY domain
PfamPF031064.5E-2414041460IPR003657WRKY domain
SuperFamilySSF1182901.83E-2115251586IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-2215261587IPR003657WRKY domain
SMARTSM007741.2E-2915261588IPR003657WRKY domain
PfamPF031066.5E-2215281586IPR003657WRKY domain
PROSITE profilePS5081119.16415281584IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043531Molecular FunctionADP binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1707 aa     Download sequence    Send to blast
MGYSSIGRKF SYLCGYKDNF DNLNKEAEKL KKKKESLQRR VDVAKANGEE IEDRVEKWLI  60
SVNKIVHEAG KFVEDEKTAK NKCFSGFCPN LKNRYQLSGK AVGKVKAVVE LQEQGKFDKS  120
GQAEGFLAFT SRTSILDKIV DALGDDSVNK IGVYGKGGIG KTTLAKEVAR EVKEDRLFDK  180
VVFAEVSRTP DVKRIQGQIA DQLDLKFYAE SESERAMMLY DRLKEEKMLV ILDNIWTGLD  240
LERVGIPSGD DYKGCKVLLT SRMLYVLSND MGCQKNYLVS VLTKYEAWSL FQKMVGHYID  300
NPDLQPIAVD VASICAGWPI VIVTVATALR NKSVLEWKDA LIKLSRSSLE NITDVDPVVY  360
STIELSYNHL DDQEAKSTFL LCSLMKHPYD VPIMDLLKYA VGLGLFNDTN TMEETRDRVY  420
SLVHKLKGSG LLCDGHTSEC FSMHDVVRDV AISIASREQH VFTLQNKVVQ RESTGKGIVK  480
SCTAISSHTS NIAELPQGLE CPQLKLFYMH AKDSFCKISD NFFTGRTELR VLVLTEVSLF  540
LPSSFHLLVN LQTLCLDQCI LGDIANIGNL KKLQILSLCC SNIEHLPGEI GQLTQLRLLD  600
LSKCRNLKVI SPNVISSLSQ LEELYMGNTS VEWEFDGLSI GGNNANLNEF QHLCHLTRLE  660
IHIQDAKILP KGLFSRELKR YKILIGDEWD WFGNYDNTRT LKLKLNTNVY PEVGVILQLK  720
GIEDLYLDEV QGVGNILCKL DGAGSPQLKH LHVQNNPYIL CIVDSMESVP CDAFPVLESL  780
SLFNLMKLER ICNGQLTRGS FCKLKVIKVG NCDKLKNIFS FSIVRGLPLL QTIKVNKCEN  840
MEVIFTNGRE DDVNYNEVID KIELGWLHSL TLKFLPQLTS FCSKVKPPSK FRKRQEHLTT  900
FTWSNEVSKD DLGAPLSLFN EKVVFPNLEA LELCAISFEK IWENELASYF QNLTRLIVRG  960
CVRNLSQLQH LEICCCMVLE EIVSVEGEPE ETPKFVFPRV TFLKLWNLPQ LRTFYPGLHT  1020
LDWPLLKRLE VYGCDKVNIF SKSFSCQRTE KVQLDMPAQH SLFLVEKSAT LPLGLLKRFN  1080
SLEKLELRWS SYKEVFSYGD QEKQTGMCTQ MKSLKLWKLS NLKHMWELDS IFNNLEVLEV  1140
WWCDNLINLV PNLTFQNLTI LEVWHCKRLI KLLTLSTAKS LVRLVKMRIK GCQMMTEIIA  1200
DEGHFVADEI IFSKLKWLSL ESLESLTSFS FCNYPLKFPS LEDLYVIECP KMEIFSYGVL  1260
STPMVQEVRQ NWGLGKGRWE GGLNKTIQQL HWEKMLFRAQ QESVTLWPPQ IDPSLEDWLK  1320
FSVTQGKKKM IQTKPSAKEN PFTTRGQMVG KDMTNISMIL RGKGEDVQTK DAPDSGSGLL  1380
SKKRQSREFR CTLTVRSAEL SLFDGYTWRK YGQKDIMGSK FPRSYFRCAH RPCPATKQVQ  1440
QLDDDPAIFE VTFLGMHTCP VASTAPAVLP SSAKITQETT ERQTNSQDVE PLVPSVIPLA  1500
EKITKEELRS CEFRCTLTVS WARLALVDGY TWRKYGQKDI MGSKFPRIYY ICTHSTLYNC  1560
SAKKRVQQLN DDPASFEVTY VGMHKCCSVS STAPTALPPS LKITQEMTAR QTTLELPRPI  1620
TPSILKILVN CHKWSSEETT FEDTGEWSLE RSSEEISFED IGTVSGSTDT ITGGSTEMSM  1680
AKGHGGGSGL SPLDLVERLV IDTLYQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6ir8_A4e-1814011586768OsWRKY45
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006478613.10.0probable disease resistance protein At4g27220 isoform X3
TrEMBLA0A067FD100.0A0A067FD10_CITSI; Uncharacterized protein (Fragment)
STRINGXP_006478612.10.0(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40740.19e-27WRKY DNA-binding protein 55