PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20463_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 185aa    MW: 20522.3 Da    PI: 6.7477
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20463_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53.2e-4510108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+
  Neem_20463_f_1  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVQRLQKELE 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  Neem_20463_f_1 105 AANA 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.0229110IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4410107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS YLQRQVQRLQ KELEAANADL IRYACNEIPT  120
ALPAPPPVGS IEPVVPRQRP IEFSRRISNE GEGFYQPSVY PHPYILPWND NPSGDINQGG  180
GEGNM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4477191e-118AM447719.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X240773.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007036350.11e-114Lateral organ boundaries domain family protein
SwissprotQ9FML43e-74LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A061FUD51e-114A0A061FUD5_THECC; Lateral organ boundaries domain family protein
STRINGPOPTR_0015s09370.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-75LBD family protein