PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20361_a_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 163aa    MW: 18377.4 Da    PI: 11.0477
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20361_a_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3352.5e-113465499
                    EETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 54 kksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    ++++r++lt+GW+ Fv+a++L +gD+v+F   ++++ +l+++++r+
  Neem_20361_a_2  3 RQPKRHLLTTGWSVFVSAKRLVAGDSVLFI--WNEKNQLLLGIRRA 46
                    67899*************************..8889999****996 PP

2Auxin_resp1241e-4071154183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     aahaa+t+s F+v+YnPras+seFv++++k++ka+  ++vsvGmRf+m fete+ss rr++Gt++g+sdldpvrWpnS+Wrs+k
  Neem_20361_a_2  71 AAHAAATNSCFTVFYNPRASPSEFVIPLSKYVKAVFhTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVK 154
                     79********************************87599******************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.052147IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.5E-15360IPR015300DNA-binding pseudobarrel domain
PfamPF023627.1E-9346IPR003340B3 DNA binding domain
SuperFamilySSF1019366.8E-13474IPR015300DNA-binding pseudobarrel domain
PfamPF065079.3E-3671154IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MLRQPKRHLL TTGWSVFVSA KRLVAGDSVL FIWNEKNQLL LGIRRAIRPP TVMPSSVLSS  60
DSMHIGLLAA AAHAAATNSC FTVFYNPRAS PSEFVIPLSK YVKAVFHTRV SVGMRFRMLF  120
ETEESSVRRY MGTITGISDL DPVRWPNSHW RSVKVIDIVF TLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A7e-684155217368Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021592738.11e-101auxin response factor 8-like isoform X2
RefseqXP_021647232.11e-101auxin response factor 8-like isoform X2
SwissprotA2YG674e-88ARFQ_ORYSI; Auxin response factor 17
SwissprotQ653U34e-88ARFQ_ORYSJ; Auxin response factor 17
TrEMBLF6HFY51e-100F6HFY5_VITVI; Auxin response factor
STRINGVIT_04s0079g00200.t011e-100(Vitis vinifera)
STRINGcassava4.1_001923m1e-100(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.13e-88auxin response factor 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]