PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_20048_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family B3
Protein Properties Length: 349aa    MW: 40135.9 Da    PI: 9.9604
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_20048_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.91.6e-17131051100
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffkv ++s    +++l++p kf++++g +       tl  ++g  Wev l  +k ++++++ +GW +Fv+ + +++g f+vF++ ++s+f  +v 
  Neem_20048_f_1  13 FFKVILQSTIE-NKMLRIPEKFVRRFGDE--LFSVATLVVPEGGAWEVGL--KKDGRKIWFHDGWIDFVEFHSICAGHFLVFEYRENSSF--HVL 100
                     77777665555.557***********755..44589999***********..999999**************************988999..*** PP

                     EE-SS CS
              B3  96 vfrks 100
                     +f+ks
  Neem_20048_f_1 101 IFDKS 105
                     **985 PP

2B351.71.6e-16254346499
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       t  +++   r ++p kfa+++  + ++ k ++++d++g++W v+l   + s+++ l++GW+ F k  +L  gD++vF+l+ ++   l+++v+r
  Neem_20048_f_1 254 FKTARYNGGYERKYVPAKFADKYLRSDTTAKFIKIQDSDGKEWPVRL---RWSQWCGLKGGWRAFRKGMNLGGGDVCVFELIMKKVIVLKFSVLR 345
                     556788999999***********445567789***************...6677889***********************997777777777776 PP

                     S CS
              B3  99 k 99 
                     +
  Neem_20048_f_1 346 A 346
                     5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.0E-257107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.43E-249107IPR015300DNA-binding pseudobarrel domain
CDDcd100171.01E-2111103No hitNo description
PROSITE profilePS5086313.71912105IPR003340B3 DNA binding domain
SMARTSM010197.6E-2113105IPR003340B3 DNA binding domain
PfamPF023621.8E-1413104IPR003340B3 DNA binding domain
SMARTSM010192.3E-10251347IPR003340B3 DNA binding domain
PROSITE profilePS5086312.238251347IPR003340B3 DNA binding domain
PfamPF023624.2E-15253345IPR003340B3 DNA binding domain
CDDcd100175.20E-13256345No hitNo description
Gene3DG3DSA:2.40.330.101.4E-15261346IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.29E-14262335IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MGAGSRRAEP PHFFKVILQS TIENKMLRIP EKFVRRFGDE LFSVATLVVP EGGAWEVGLK  60
KDGRKIWFHD GWIDFVEFHS ICAGHFLVFE YRENSSFHVL IFDKSACEIE YPSIWKEPKN  120
EEQNSVHGNE MEREDSDECP SNRPSSKMNT PQLQKIQVKP SFGSALGTKR RQKCAMSLES  180
SKLKYGYMTR NRKSKMEETA EMDESRQGKL QGNEMCNSQG SLHHKRHLLR NAENLYASSS  240
LARKMDSKID GTKFKTARYN GGYERKYVPA KFADKYLRSD TTAKFIKIQD SDGKEWPVRL  300
RWSQWCGLKG GWRAFRKGMN LGGGDVCVFE LIMKKVIVLK FSVLRASAE
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15912578
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.12e-42B3 family protein