PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_19880_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 328aa    MW: 37276.3 Da    PI: 7.6212
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_19880_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-192879556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++t++q++ Le++F+ +++p++++r++L+++lgL+ +q+k+WFqN+R++ k
  Neem_19880_f_1 28 HRHTAYQIQSLETFFKDCPHPDENQRRQLSRELGLDPKQIKFWFQNKRTQTK 79
                    6789********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-21775IPR009057Homeodomain-like
SuperFamilySSF466897.52E-191082IPR009057Homeodomain-like
PROSITE profilePS5007116.6652181IPR001356Homeobox domain
SMARTSM003892.1E-162185IPR001356Homeobox domain
CDDcd000869.55E-162482No hitNo description
PfamPF000465.7E-172879IPR001356Homeobox domain
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084811.127223328IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDFVARNGSN SGDEQEHSNS RKGKKTFHRH TAYQIQSLET FFKDCPHPDE NQRRQLSREL  60
GLDPKQIKFW FQNKRTQTKA QNERADNSIL RAENERIQCE NLAIREALKN VICPACGGPP  120
FGEEERQRSL EKLQLENAQL KEEASTPSFH EKVSNLLAKY IGKPISQINP LMPVPISTPT  180
SGPVVDHPVP VPAVFPIQDM DLDLNSSGNS ENIPLTFQLK GISDVDKALM VESVNSAMDQ  240
LIRLLQINEP LWIKSSSDGR YTIHRDSYEK IFPRVSHFKT STSRLESSKC SGMVTMNAMQ  300
LVDVFLDSVS FHNYSLPVKH KIDLIIYR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526595.21e-141homeobox-leucine zipper protein ROC8 isoform X2
RefseqXP_015579295.11e-141homeobox-leucine zipper protein ROC8 isoform X3
TrEMBLA0A2H5PLL61e-134A0A2H5PLL6_CITUN; Uncharacterized protein
TrEMBLV4S6731e-134V4S673_9ROSI; Uncharacterized protein
STRINGXP_006421085.11e-135(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.12e-85homeodomain GLABROUS 11