PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_19819_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 166aa    MW: 18903.4 Da    PI: 10.494
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_19819_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY109.51.6e-341573159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  Neem_19819_f_1 15 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVVTTYEGKHNHD 73
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.5E-37275IPR003657WRKY domain
SuperFamilySSF1182901.57E-30775IPR003657WRKY domain
PROSITE profilePS5081138.7441075IPR003657WRKY domain
SMARTSM007742.4E-391574IPR003657WRKY domain
PfamPF031061.0E-261673IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
EPRIIVQTTS EVDLLDDGYR WRKYGQKVVK GNPYPRSYYK CTTPGCNVRK HVERASTDPK  60
AVVTTYEGKH NHDVPAAKSS SHNTANNNAS QIQPQNARTD FGNNNQQPVA RLRHDKRPQD  120
KQKRRSAVIR HVFKNLFLTL MAIVFIMLLE KAFPETSMDI AIAKNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-47676878Probable WRKY transcription factor 4
2lex_A1e-47676878Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119124DKQKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021299606.14e-66probable WRKY transcription factor 3
SwissprotQ9ZQ701e-55WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLG3FFB02e-72G3FFB0_9ROSI; WRKY transcription factor 2-4
STRINGEOY018123e-64(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.14e-52WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]