PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_17921_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family NAC
Protein Properties Length: 625aa    MW: 69955.7 Da    PI: 4.5302
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_17921_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.72.2e-53101371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeel+ +yLk+kv +k++++ + i+ +diyk+ePwdLp k k+k+++kewyfFs  dkky +g+r+nrat++gyWk+tgkd++v+
  Neem_17921_f_2  10 LAPGFRFHPTDEELIRYYLKRKVCNKPFRF-DPISVIDIYKSEPWDLPdKsKLKTRDKEWYFFSMLDKKYGNGSRTNRATEKGYWKTTGKDRPVH 103
                     579**************************9.99**************96358889999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++++vg+kktLv++ grap+ge+t+Wvmheyrl
  Neem_17921_f_2 104 H-NTRTVGMKKTLVYHIGRAPRGERTNWVMHEYRL 137
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-628160IPR003441NAC domain
PROSITE profilePS5100558.1810160IPR003441NAC domain
PfamPF023655.7E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MGRDGASTSL APGFRFHPTD EELIRYYLKR KVCNKPFRFD PISVIDIYKS EPWDLPDKSK  60
LKTRDKEWYF FSMLDKKYGN GSRTNRATEK GYWKTTGKDR PVHHNTRTVG MKKTLVYHIG  120
RAPRGERTNW VMHEYRLTDE ELEKAGVAQD AFVLCRIFQK SGSGPKNGEQ YGAPFIEEEW  180
EDDEVVEAAL VPGQDMVADE LVVGDDAYFE TTDLDQVKEI VCSVSELPGD TVFVHSLYEC  240
VPSTQNPEVA NQSENATHPL NFYYGDSSNH VEHSRDLSAD DQKPMIGMDE NQHDSGLRAE  300
QKFSDMPRQY EMDTRPVKDE HIESSNNVSA GGVNYLLDEP YLDATDNPPF SDGLYLEAND  360
LSHTLEADSE GFDMVEEYLN FFDANDDNSE YLTFDASEIM GSENNISDQA PLTTEQVNEV  420
PDQVSMAGQP QSEAHGNDEA STSKQKPDAT KFESDIKYPF LKQASQMLGG FPAPPAFASE  480
FPTKDAALRL NSVAQPSSSV HVTAGMIRIR NITLSGTGLD WSIGKNGDVN IVFSFDLSQS  540
DVSPINSGNF LFGKTGTLTS RSLLFFLFFW VLILSVSFKI GTCIYTKLTA AVQHSGMIKF  600
LADAQVLPMD SNLKLYTTLG RTRGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-48916616171NO APICAL MERISTEM PROTEIN
1ut4_B7e-48916616171NO APICAL MERISTEM PROTEIN
1ut7_A7e-48916616171NO APICAL MERISTEM PROTEIN
1ut7_B7e-48916616171NO APICAL MERISTEM PROTEIN
3swm_A8e-48916619174NAC domain-containing protein 19
3swm_B8e-48916619174NAC domain-containing protein 19
3swm_C8e-48916619174NAC domain-containing protein 19
3swm_D8e-48916619174NAC domain-containing protein 19
3swp_A8e-48916619174NAC domain-containing protein 19
3swp_B8e-48916619174NAC domain-containing protein 19
3swp_C8e-48916619174NAC domain-containing protein 19
3swp_D8e-48916619174NAC domain-containing protein 19
4dul_A7e-48916616171NAC domain-containing protein 19
4dul_B7e-48916616171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436536.10.0NAC domain-containing protein 78 isoform X1
RefseqXP_006485307.10.0NAC domain-containing protein 78 isoform X1
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLV4TJ360.0V4TJ36_9ROSI; Uncharacterized protein
STRINGXP_006485307.10.0(Citrus sinensis)
STRINGXP_006436536.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-160NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]