PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_17588_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 115aa    MW: 13554.8 Da    PI: 10.8758
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_17588_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF58.39.5e-191053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    r e+   rq+ +skR+ g+lKKA+EL vLCd++ ++++fs+tg+
  Neem_17588_f_1 10 RLESMKARQTKYSKRKIGLLKKAKELAVLCDTDLSLLMFSPTGR 53
                    6789999***********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.89161IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-24160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-22281IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-16323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-171155IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MGRRKLRIRR LESMKARQTK YSKRKIGLLK KAKELAVLCD TDLSLLMFSP TGRPSLYVGQ  60
NNDLSTVLER LSKLSIEDRE ERRGYTMKML KKIYANSEVD PRNFSLDRGY RYTFN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012432.16e-50PREDICTED: agamous-like MADS-box protein AGL65
TrEMBLA0A2H5NBQ53e-65A0A2H5NBQ5_CITUN; Uncharacterized protein
STRINGXP_006474504.12e-63(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73301838
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26320.11e-27AGAMOUS-like 33