PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_16665_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 191aa    MW: 21140.3 Da    PI: 9.5022
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_16665_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.66e-201874157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    ++kR   t++qle+Le+ ++ ++yps++ r+eL+ +lgL++rq ++WF+ rR k++k
  Neem_16665_f_1 18 KSKRKMKTASQLEILEKTYAVESYPSEAVRAELSVQLGLSDRQLQMWFCHRRLKDRK 74
                    689****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-19474IPR009057Homeodomain-like
SuperFamilySSF466894.06E-171374IPR009057Homeodomain-like
PROSITE profilePS5007116.5841575IPR001356Homeobox domain
SMARTSM003893.1E-161779IPR001356Homeobox domain
PfamPF000461.6E-171874IPR001356Homeobox domain
CDDcd000863.14E-151874No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MEAASEGEKK KPQEGETKSK RKMKTASQLE ILEKTYAVES YPSEAVRAEL SVQLGLSDRQ  60
LQMWFCHRRL KDRKAPPAKR QPKDSQPPAR LTPAGGNELA GSEFVRGGVA VQRIGADVAA  120
MRRCYEMSLP PPPPPPQRSI AELRAIALVE AQLGEPLRED GPILGVEFDP LPPDAFGRPL  180
GKLFRPEFDK M
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024047748.11e-75homeobox-DDT domain protein RLT2 isoform X5
RefseqXP_024047752.11e-75homeobox-DDT domain protein RLT2 isoform X8
SwissprotQ9FFH13e-48RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A067E2X05e-75A0A067E2X0_CITSI; Uncharacterized protein (Fragment)
TrEMBLV4W2062e-74V4W206_9ROSI; Uncharacterized protein
STRINGXP_006446705.14e-75(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2568133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.18e-51Homeodomain-like transcriptional regulator