PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1639_f_10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 451aa    MW: 49313 Da    PI: 5.3609
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1639_f_10genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY86.32.8e-27103159259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK v+g+ef rsYY+Ct ++Cp+kk++++++ d+++ +++Y geH h+
  Neem_1639_f_10 103 EDGYNWRKYGQKLVRGNEFVRSYYKCTNSSCPAKKQLDCTH-DGQIADTIYFGEHCHP 159
                     7**************************************99.***************7 PP

2WRKY84.69.5e-27276330159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK vkg+++pr    C+s+gCp+kk+ver+++dpk+v++tYeg+H+he
  Neem_1639_f_10 276 VNDGYRWRKYGQKLVKGNPNPR----CSSSGCPAKKHVERASHDPKLVITTYEGQHDHE 330
                     58*******************6....********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081119.70397161IPR003657WRKY domain
SuperFamilySSF1182906.15E-2297160IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-2498160IPR003657WRKY domain
SMARTSM007746.8E-29102160IPR003657WRKY domain
PfamPF031063.0E-21103159IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.0E-29262332IPR003657WRKY domain
SuperFamilySSF1182902.22E-23268332IPR003657WRKY domain
PROSITE profilePS5081129.861271332IPR003657WRKY domain
SMARTSM007742.5E-32276331IPR003657WRKY domain
PfamPF031064.4E-20277329IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MVSSPEDVVD KVASDKLQEG PCAESVSETH ALQCDQQVSM PPRIPNKEPM APTDTGHSMP  60
MDQERSISFV TSEKASETTD IVHASQTGQE GSNPMIMREK VSEDGYNWRK YGQKLVRGNE  120
FVRSYYKCTN SSCPAKKQLD CTHDGQIADT IYFGEHCHPR LPNLPLAVGF VVSIVEEKPD  180
DSSSSIAKDK SSDVRGQTPC QIEPTDNPRP SVVSVSDGVK GSPLQSNKIK DEVDNDDRPG  240
SKRRKKDNYN TSATIVERPS GEQRVVVQTL SEIDFVNDGY RWRKYGQKLV KGNPNPRCSS  300
SGCPAKKHVE RASHDPKLVI TTYEGQHDHE MPPSRTVTHN VAGTTSNKTA NNGESATKLE  360
ENDPTCPDTA VHSSSDLPSK SSEEQNSQPG TIEGSDIGQD TVVHASSCHK SGANDKSNCE  420
SETKSEQNGT ACRETNFSEQ EQTPKTEAVQ S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-31101333275WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447745.10.0WRKY transcription factor 1
RefseqXP_006469519.10.0WRKY transcription factor 1
SwissprotQ9SI372e-78WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A2H5PLC60.0A0A2H5PLC6_CITUN; Uncharacterized protein
TrEMBLV4UA120.0V4UA12_9ROSI; Uncharacterized protein
STRINGXP_006469519.10.0(Citrus sinensis)
STRINGXP_006447745.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.28e-78zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]