PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_15705_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family BES1
Protein Properties Length: 427aa    MW: 46957.9 Da    PI: 8.3147
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_15705_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822216.37.4e-6721451150
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++r ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sa asp+ss++
  Neem_15705_f_1   2 TSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEPDGTTYRKGCKPVERMDIVGGSAAASPCSSYH 96 
                     5899******************************************************************************************* PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsssl 150
                             +sp++sy++sp+sssfpsp+s++ + + +a  +sl+p+l++ls++sss+
  Neem_15705_f_1  97 --------PSPCASYNPSPASSSFPSPASSSYAANPNAdgSSLIPWLKNLSSASSSA 145
                     ........******************98766554444444**********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056878.3E-673139IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MTSGTRLPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEPDGTTY RKGCKPVERM DIVGGSAAAS PCSSYHPSPC ASYNPSPASS SFPSPASSSY  120
AANPNADGSS LIPWLKNLSS ASSSASSSKL PHLYIHTGSI SAPVTPPLSS PTARTPRMKT  180
DWDNQSSRPG WDGQHYSFLP SSTPPSPGRQ IVPDPEWFAG IRVPQGGPNS PTFSLVSSNP  240
FGFKEEALAG GGSRMWTPGQ SGTCSPAIAA GSDHTGDVPM SEVITDEFAF GSNAKGLVKA  300
WEGERIHEEC GSDDLELTLG SSRTREPVNT RDQGELVVQG LGIWEWFHNP FIWSFSLQRQ  360
NLLKKPIYMY ELAVLRFWFA IVRKAKMTIK LECNSVAEPS SASIWMEWTF YHCLFVHSLP  420
LYDVIFV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006477843.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
RefseqXP_006477844.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X2
SwissprotQ9ZV881e-144BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A067DLE10.0A0A067DLE1_CITSI; Uncharacterized protein
STRINGVIT_19s0014g00870.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-125BES1/BZR1 homolog 4