PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1535_f_7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 487aa    MW: 53871.7 Da    PI: 6.5049
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1535_f_7genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-33265319155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr+rWtpeLHe+Fveav++L G+ekAtPk +l+lm+v+gLt++hvkSHLQkYR+
  Neem_1535_f_7 265 KPRMRWTPELHECFVEAVNKLDGAEKATPKGVLKLMNVEGLTIYHVKSHLQKYRI 319
                    79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.087262322IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-32263320IPR009057Homeodomain-like
SuperFamilySSF466895.91E-18263319IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-25265320IPR006447Myb domain, plants
PfamPF002493.8E-9267318IPR001005SANT/Myb domain
PfamPF143795.0E-23344390IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MNHHSIISVT QSESNKGVSQ SCCTALSSIH NFCVERVEHC PSTGECSSPH PSPFIQKESL  60
NSPNHMQVSM VLPQKNCLIA RPDSPMSLGS HLQHSRGTFS RSSCFCTSLY LSSSSSSETH  120
RQLGNLPFLP HPPSYNQSVS AVDSTKSPLL FSEDVGNPYE EEHPESLMKD FLNLPGDASN  180
GSFHGVTCMG DGFNEQLELQ FLSDELDIAI NDHGENPRLD EIYEAPQSSL KPILGLTCNQ  240
NYVPSAPPVD AVSSHPSPGP ASSHKPRMRW TPELHECFVE AVNKLDGAEK ATPKGVLKLM  300
NVEGLTIYHV KSHLQKYRIA KYMPEKKEVA PHMVIFVFRF LRSVQITEAL RMQMEVQKQL  360
HEQLEVQRAL QLRIEEHARY LQKILEEQKK AGSALILPQT QSLSTLNNAS KDSQLQPSSA  420
SVTVNALPDQ AQPVESKTEL SSSSSLPSKH KAIDSRDSKP DACAKRIRLE NKLEPTSDEG  480
VVENPVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-27265322259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488616.10.0myb family transcription factor PHL6
RefseqXP_006488617.10.0myb family transcription factor PHL6
SwissprotQ949U21e-134PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A067FLS10.0A0A067FLS1_CITSI; Uncharacterized protein
STRINGXP_006488616.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-116G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]