PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1516_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 366aa    MW: 41998.2 Da    PI: 9.5648
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1516_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.73e-131151343
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                   ie +  r +t+ kR+ g+ KKA+E  +LC++  ++ii++++
  Neem_1516_f_1 11 IEKEKARMITYQKRKRGLKKKAQEFTTLCGVPTCMIIYGPR 51
                   89999**********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-10164IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-16153IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.311151IPR002100Transcription factor, MADS-box
CDDcd001206.30E-17250No hitNo description
PRINTSPR004044.5E-7323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-151155IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRGKLTMEL IEKEKARMIT YQKRKRGLKK KAQEFTTLCG VPTCMIIYGP RLNNRPVDVE  60
IWPQDHQDFM AIVNSYRDKA FSSIRGVKSQ NMYNFFADRK RKVDEKIAKT RKANYESKFS  120
GGLDDLNQFS MDQLQAILSM FDYNLDVATR KLTILKGNQI LIDDSNSELL VGGCSINAAQ  180
FLFQKTMEAD VFNRQLPISS SVYMQPPYCP SDHHHHHQAL QMVPFDFNPM MVMVNGGDQM  240
GNSPYIPRHL DPMAAMIDNT SLMMNNPRPA LQFFGSTSSQ PYKQFPVLPS ISSQIQDSQF  300
HEFYGDINNS EFRHKSQTSC KYFFRAFHLK SKTLSFMNSM VTSITASFAI RARPVANMNM  360
VSSDYY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488665.11e-105agamous-like MADS-box protein AGL82
TrEMBLA0A2H5ND171e-106A0A2H5ND17_CITUN; Uncharacterized protein
STRINGXP_006488665.11e-104(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16227914
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.13e-24AGAMOUS-like 82