PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1476_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 296aa    MW: 33011.1 Da    PI: 7.0629
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1476_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY109.31.8e-34146203259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+
  Neem_1476_f_4 146 EDGYRWRKYGQKAVKDSPFPRSYYRCTSASCNVKKRVERSFNDPSIVVTTYEGQHTHP 203
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381303.4E-1111296IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.805.0E-35130205IPR003657WRKY domain
SuperFamilySSF1182901.44E-29137205IPR003657WRKY domain
PROSITE profilePS5081131.915140205IPR003657WRKY domain
SMARTSM007742.9E-40145204IPR003657WRKY domain
PfamPF031069.6E-27146203IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MENTMASSSF PDHISTSFPL QGMFDLSEGE KSSLGFMELL GIQDFGSSLF DMLQVPSTVT  60
SSSPNPTVNV TKMESPEMLN QPATPNSSSI SSASSDAVND EQVKVEEHEE NQQKTKKQLK  120
PKKTNQKRQR EPRFAFMTKS EVDHLEDGYR WRKYGQKAVK DSPFPRSYYR CTSASCNVKK  180
RVERSFNDPS IVVTTYEGQH THPSPLIPRP SLAGVQPGNG VAGSTFAMPM QGALSHYQQH  240
QQQPFVNTLL PMNFGCNGLT NASVLHERRF CIPGTELLKD HGLLQDIVPS HMLKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-271382051077Probable WRKY transcription factor 4
2lex_A8e-271382051077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ5518461e-55KJ551846.1 Gossypium hirsutum WRKY transcription factor 68 (WRKY68) gene, promoter region and complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021654615.11e-154probable WRKY transcription factor 23 isoform X1
SwissprotO229004e-74WRK23_ARATH; WRKY transcription factor 23
TrEMBLG8Z9V51e-152G8Z9V5_HEVBR; WRKY transcription factor
STRINGXP_006492359.11e-139(Citrus sinensis)
STRINGXP_006444538.11e-139(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-62WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]