PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_14065_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 111aa    MW: 12757.1 Da    PI: 10.9008
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_14065_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF1014.4e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELS+LCdaeva+iifs++gklye++s
  Neem_14065_f_1  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSNRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.347161IPR002100Transcription factor, MADS-box
SMARTSM004323.2E-41160IPR002100Transcription factor, MADS-box
CDDcd002657.04E-38261No hitNo description
SuperFamilySSF554552.49E-30261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-33323IPR002100Transcription factor, MADS-box
PfamPF003195.2E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVALIIFSN RGKLYEFCST  60
SRLLIKDGSL FGKSSVSVVF CTRSVLLIHA LFHSEILKES HRLRMNFLIN V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A6e-20161161MEF2 CHIMERA
6byy_B6e-20161161MEF2 CHIMERA
6byy_C6e-20161161MEF2 CHIMERA
6byy_D6e-20161161MEF2 CHIMERA
6bz1_A6e-20161161MEF2 CHIMERA
6bz1_B6e-20161161MEF2 CHIMERA
6bz1_C6e-20161161MEF2 CHIMERA
6bz1_D6e-20161161MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3940594e-57GQ394059.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS1024 SSR marker CGR6437 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021285782.16e-38MADS-box protein CMB1-like
SwissprotQ7Y0405e-38EJ2_SOLLC; MADS-box protein EJ2
TrEMBLS8D4L42e-36S8D4L4_9LAMI; Uncharacterized protein
STRINGPOPTR_0004s11450.14e-37(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.32e-39MIKC_MADS family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Soyk S, et al.
    Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene.
    Cell, 2017. 169(6): p. 1142-1155.e12
    [PMID:28528644]