PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_13007_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 100aa    MW: 11369.3 Da    PI: 10.4241
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_13007_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.91.7e-25958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien   rqvtf+kRr+g+lKKA+ELS+LCda++ v ifs +gklye +
  Neem_13007_f_1  9 KRIENPVHRQVTFCKRRAGLLKKAKELSILCDADIGVFIFSAHGKLYELA 58
                    79*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.1161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.46E-28175IPR002100Transcription factor, MADS-box
SMARTSM004325.3E-35160IPR002100Transcription factor, MADS-box
CDDcd002651.82E-38276No hitNo description
PRINTSPR004048.9E-27323IPR002100Transcription factor, MADS-box
PfamPF003192.8E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSILCD ADIGVFIFSA HGKLYELATK  60
GTMQGLIERY SKSTRGPQAE PVVETTQPSE QKEYIIARYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-16192194MEF2 CHIMERA
6byy_B2e-16192194MEF2 CHIMERA
6byy_C2e-16192194MEF2 CHIMERA
6byy_D2e-16192194MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006478219.19e-53agamous-like MADS-box protein AGL12
SwissprotA2YQK95e-41MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G85e-41MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLV4T3Q31e-50V4T3Q3_9ROSI; Uncharacterized protein
STRINGXP_006478219.14e-52(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70522641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.18e-42AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]