PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_12847_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 261aa    MW: 30071.1 Da    PI: 10.0621
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_12847_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-323891255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtp+LH +Fv+ave+LGG+++AtPk +l++m+v gLt++hvkSHLQ+YR+
  Neem_12847_f_1 38 PRLRWTPDLHLSFVHAVERLGGEDRATPKMVLQIMDVRGLTISHVKSHLQMYRS 91
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.5843494IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-313493IPR009057Homeodomain-like
SuperFamilySSF466896.81E-153692IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-243892IPR006447Myb domain, plants
PfamPF002493.0E-73990IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MKKKADSAES SCSQSSSNRP EISLKSPGVR PYVRSKMPRL RWTPDLHLSF VHAVERLGGE  60
DRATPKMVLQ IMDVRGLTIS HVKSHLQMYR SMKHEQMIQE AARAAKRNVN SNKVLDPIYC  120
HQNHHLKYLN LMNNNAQRNQ SFRILHYSES LAHLRNNPNV PAYWEEKQHM WIGKEELITN  180
TEMEQRSNSY FIFKDLLKSY TAQKEQEKLS KAYQNSSEND VSREGSLSLS LASKVSPPLR  240
KLSKAYQNSS ENDVSLDLTL A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-203994358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-203994358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-203994358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-203994358Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021598244.11e-71putative Myb family transcription factor At1g14600
TrEMBLA0A2H5N4R33e-71A0A2H5N4R3_CITUN; Uncharacterized protein (Fragment)
STRINGcassava4.1_021436m4e-71(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.12e-33G2-like family protein