PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1195_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 198aa    MW: 22842.9 Da    PI: 8.1201
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1195_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.83.8e-38121111100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCa+Ck++rrkC+k+C la+yfpa+qpk+f+n+h+lFG+s + k+l++++++++++am+s+++e+++ra+ Pv+G++g+i++l++ql+ +  el +
  Neem_1195_f_2  12 ACAVCKYQRRKCQKNCRLARYFPADQPKTFQNAHRLFGVSGIAKILNNVDDDKKDRAMASIIFESNIRAKYPVNGCLGLIFSLEKQLQAAVDELRH 107
                    7********************************************************************************************999 PP

         DUF260  97 lkee 100
                    ++++
  Neem_1195_f_2 108 VNTQ 111
                    9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.64111112IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3512108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MTIKGEGGTK QACAVCKYQR RKCQKNCRLA RYFPADQPKT FQNAHRLFGV SGIAKILNNV  60
DDDKKDRAMA SIIFESNIRA KYPVNGCLGL IFSLEKQLQA AVDELRHVNT QLAICREQTQ  120
YQTPTSSSNP SEIRIDVNNL IEQSGNLDDH EFYVDINEDV KPFVRNIDEQ NYGFIHRIYD  180
INQKNIKAEL HMDWLQKF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482664.16e-67PREDICTED: LOB domain-containing protein 3-like
SwissprotQ9STS68e-39LBD27_ARATH; LOB domain-containing protein 27
TrEMBLV4SU832e-66V4SU83_9R
STRINGVIT_14s0066g02460.t016e-44(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.15e-40LOB domain-containing protein 27