PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11875_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 156aa    MW: 17381.4 Da    PI: 7.7922
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11875_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.61.6e-361610511100
          DUF260  11 kCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la++++e
  Neem_11875_f_4  16 ICVEKCVLAPYFPPTEPYKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICHLQKQVSELQAQLAKAQAE 105
                     6*************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.6385106IPR004883Lateral organ boundaries, LOB
PfamPF031955.1E-3616103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MDIHKLMTSS SGLGDICVEK CVLAPYFPPT EPYKFTIAHR VFGASNIIKF LQELPESQRA  60
DAVSSMVYEA NARIRDPVYG CAGAICHLQK QVSELQAQLA KAQAELVTMQ CQQRNLIAVI  120
CMEMAQAQAP AAFWLKLGGS LDMMKEEKLI ELRKKF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1528183e-38AC152818.17 Medicago truncatula clone mth2-85g12, complete sequence.
GenBankAC1444843e-38AC144484.5 Medicago truncatula clone mth2-30o16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006436214.11e-71hypothetical protein CICLE_v10033956mg, partial
RefseqXP_006485928.14e-71PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR04e-60LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A067E1555e-71A0A067E155_CITSI; Uncharacterized protein
TrEMBLV4VB101e-71V4VB10_9R
STRINGGLYMA20G31780.13e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-51LOB domain-containing protein 1