PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11875_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 190aa    MW: 21428.2 Da    PI: 8.0422
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11875_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.34e-41131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+lapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+v+eA+ar+r+PvyG++g i+ lq+q  +l+ae+a
  Neem_11875_f_3  13 PCAACKILRRRCAEKCILAPYFPPTEPHKFIIAHRVFGASNIIKFLQELPENQRADAVSSMVFEANARIRNPVYGCAGAISLLQKQAIELQAEVA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Neem_11875_f_3 108 KAQAE 112
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.79412113IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4013110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MQTSSSPPIV LSPCAACKIL RRRCAEKCIL APYFPPTEPH KFIIAHRVFG ASNIIKFLQE  60
LPENQRADAV SSMVFEANAR IRNPVYGCAG AISLLQKQAI ELQAEVAKAQ AELVSMQFEQ  120
KNLIALICME MTAQSDQDHS MNMFRLYDLG SSLDMKMVMF DRYLAREEFQ KRLVLSSYMN  180
GLCPFPILIS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.19e-74PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-69LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5W0704e-73M5W070_PRUPE; Uncharacterized protein
TrEMBLV4VB102e-73V4VB10_9R
STRINGPOPTR_0008s04350.11e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-70LOB domain-containing protein 1