PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11510_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family YABBY
Protein Properties Length: 169aa    MW: 18937.9 Da    PI: 9.2225
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11510_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY43.11.6e-1334732261
           YABBY 22 lavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61
                    + vsvP +s+f++vtvrCGhC++llsv++  + q++++++
  Neem_11510_f_1 34 VYVSVPCSSMFNIVTVRCGHCANLLSVSMGSSLQTIPVQD 73
                    359*****************************99999987 PP

2YABBY122.65.9e-3894148116170
           YABBY 116 irPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     +  PekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Neem_11510_f_1  94 NAAPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 148
                     668**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.3E-143473IPR006780YABBY protein
PfamPF046902.8E-3692148IPR006780YABBY protein
SuperFamilySSF470954.97E-895141IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.8E-596142IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MKPDLGTKVV GFVDGVYCYK FKCTTIWVET YVSVYVSVPC SSMFNIVTVR CGHCANLLSV  60
SMGSSLQTIP VQDPQLCLLP LKLTYLGFST VINNAAPEKR QRVPSAYNRF IKEEIQRIKA  120
SNPDISHREA FSTAAKNWAH FPHIHFGLKV DGNKQAKLDQ TFAEGTQKY
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021279063.12e-68putative axial regulator YABBY 2
SwissprotQ8GW462e-50YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A061GUT16e-67A0A061GUT1_THECC; Plant-specific transcription factor YABBY family protein isoform 1
STRINGEOY332269e-68(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55812749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.27e-48YABBY family protein
Publications ? help Back to Top
  1. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]