PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11316_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 117aa    MW: 13062.1 Da    PI: 8.8402
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11316_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.3e-3971061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dC+++pyfpa++p++fa vhk++G snv k+l++lp + r +a++++ +eA+ r++dPvyG+vg+i+ l+qq++ ++++la
  Neem_11316_f_3   7 RCAACKYLRRRCPSDCIFSPYFPASNPRRFAWVHKIYGSSNVAKMLQQLPVHLRAEAAECISFEAQRRVEDPVYGCVGIISLLHQQIHDAESQLA 101
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++k+e
  Neem_11316_f_3 102 KAKAE 106
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.666107IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-397104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MSGVTGRCAA CKYLRRRCPS DCIFSPYFPA SNPRRFAWVH KIYGSSNVAK MLQQLPVHLR  60
AEAAECISFE AQRRVEDPVY GCVGIISLLH QQIHDAESQL AKAKAELAVL NSRDAQL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318256.29e-63hypothetical protein POPTR_0012s13910g
SwissprotP594682e-50LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9I4F91e-62B9I4F9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13910.13e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.19e-52LOB domain-containing protein 24