PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11290_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 217aa    MW: 24948 Da    PI: 10.2907
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11290_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.11.7e-161051243
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    +i  +  r  tf kR+  ++KK +E S+LCd+ev++ii++++
  Neem_11290_f_2 10 PIRHDKARLATFKKRKGSLMKKVHEFSTLCDVEVCIIIYGPK 51
                    5777889999******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.101151IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-8161IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-7323IPR002100Transcription factor, MADS-box
CDDcd002669.78E-16750No hitNo description
SuperFamilySSF554554.84E-17780IPR002100Transcription factor, MADS-box
PfamPF003197.7E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MDSQPHKLEP IRHDKARLAT FKKRKGSLMK KVHEFSTLCD VEVCIIIYGP KLKNLPVKAE  60
TWASREGKLI DIIRKYKKAA TTADDVQRRS TLSLSKVGKN KTPQVEDDDA TRLRKKKCVA  120
KYTTWDQRMD NFTEDQLKMV IDTMDHKLKL VDKKLNMFRG GRKVMKKAAS LKLLDHDYSH  180
LDADTHQKHD AKPLNLELTI GLLPHHQVSP ELPSDLS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430718.16e-71agamous-like MADS-box protein AGL82
RefseqXP_024037550.16e-71agamous-like MADS-box protein AGL82
TrEMBLV4S8X51e-69V4S8X5_9ROSI; Uncharacterized protein
STRINGXP_006482193.12e-70(Citrus sinensis)
STRINGXP_006430718.12e-70(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2105535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.12e-25AGAMOUS-like 82