PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_11232_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 599aa    MW: 65097.3 Da    PI: 9.3687
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_11232_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.75.7e-34253309259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dD ynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++v+ei+Y+g+Hnh+
  Neem_11232_f_2 253 DDPYNWRKYGQKQVKGSEFPRSYYKCTHPNCPVKKKVERSL-DGQVTEIIYKGQHNHP 309
                     89***************************************.***************8 PP

2WRKY106.51.3e-33448506159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+
  Neem_11232_f_2 448 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVVTTYEGKHNHD 506
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-29243311IPR003657WRKY domain
SuperFamilySSF1182903.79E-26250311IPR003657WRKY domain
SMARTSM007742.0E-37252310IPR003657WRKY domain
PROSITE profilePS5081123.41253311IPR003657WRKY domain
PfamPF031061.2E-25253309IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.7E-37433508IPR003657WRKY domain
SuperFamilySSF1182901.57E-29440508IPR003657WRKY domain
PROSITE profilePS5081138.744443508IPR003657WRKY domain
SMARTSM007742.4E-39448507IPR003657WRKY domain
PfamPF031068.4E-26449506IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MAENEKRAPT TSSAPSKPSS APPRPTITLP PRGPFTESLF NNNGPGSGLG LGFSPGPMTL  60
VSNFFSDSDE CKSFSQLLAG AMASPAAGGQ LRPSFPDQAE RSSGDGVSGG GGGDIRFKQS  120
RPSGLVIAQP PPIFAVPPGL SPATLLDSPN LGLFSPAQVP FGMTHQQALA QVTAQAAQAQ  180
SHMQIPAEYP SSLSSAPPTS MPQVPSFTAN TTTHQQMPLS MPESSLQTKE SSDFSHSDQR  240
SQPSSYVVDK PADDPYNWRK YGQKQVKGSE FPRSYYKCTH PNCPVKKKVE RSLDGQVTEI  300
IYKGQHNHPP PQSNKRGKDG QVTEIIYKGQ HNHPPPQSNK RGKDSGSLNG TSNNQGSSDL  360
NKLKDGVPGY SMSKKDQEST QVTPENISGT SDSEEVGDAE TGVIEKDEDE PDPKRQNTEV  420
RVSETTGSHR TVTEPRIIVQ TTSEVDLLDD GYRWRKYGQK VVKGNPYPRS YYKCTTPGCN  480
VRKHVERAST DPKAVVTTYE GKHNHDVPAA KSSSHNTANN NASQIQPQNA RTDFGNNNQQ  540
PVARLRHDKR PQDKQKRRSA VIRHVFKNLF LTLMAIVFIM LLEKAFPETS MDIAIAKNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-43253509878Probable WRKY transcription factor 4
2lex_A1e-43253509878Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1552557DKQKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483086.10.0probable WRKY transcription factor 4 isoform X1
RefseqXP_006483087.10.0probable WRKY transcription factor 4 isoform X2
SwissprotQ9ZQ700.0WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A067GWH80.0A0A067GWH8_CITSI; Uncharacterized protein
STRINGXP_006483087.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-160WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]