PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10925_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 533aa    MW: 58744 Da    PI: 6.8467
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10925_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.82.3e-33243300260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Neem_10925_f_1 243 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 300
                     8****************************************.***************85 PP

2WRKY106.81.1e-33414472159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Neem_10925_f_1 414 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHD 472
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28232301IPR003657WRKY domain
SuperFamilySSF1182901.06E-25238301IPR003657WRKY domain
SMARTSM007741.3E-36242300IPR003657WRKY domain
PfamPF031061.1E-25243299IPR003657WRKY domain
PROSITE profilePS5081123.824243301IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.6E-38399474IPR003657WRKY domain
SuperFamilySSF1182901.07E-29406474IPR003657WRKY domain
PROSITE profilePS5081138.147409474IPR003657WRKY domain
SMARTSM007741.2E-39414473IPR003657WRKY domain
PfamPF031064.5E-26415472IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MASSGAANVD ALSNSHPTNN FTFSTHPFMT TTSFTDLLAS PSPAELSDAN NNTTSRGLSD  60
RIAERTGSGV PKFKSIQPPS LPISPPSLFS PSSYFAIPPG LSPAELLDSP VLLSTSNILP  120
SPTTGTFPSQ AFNWKNNSSS NQQNLKQEDK NKSDFSFQTQ TRPNTTSSTV FQSTAATIQT  180
QQQPWNYHES TKQDVKSEYA SVQNFSSEIA TLQTKNQSNN GLQPDYGNYH QQSQSIRDSR  240
KSDDGYNWRK YGQKQVKGSE NPRSYYKCTY PNCPTKKKVE RSLDGQITEI VYKGSHNHPK  300
PQSTRRSSSS VGSNAFQANS QPSVDIQDQS FATHGSVQMD SGATPENSSI SVGDDDVDQG  360
SQKSKSAGED FDEDEPEAKR WKIEGESEGI SAPGSRTVRE PRVVVQTTSD IDILDDGYRW  420
RKYGQKVVKG NPNPRSYYKC THPGCPVRKH VERASHDLRA VITTYEGKHN HDVPAARGSQ  480
SPFTLEMLQN PGSFGFQGFG NAYMNEAQPT DNALSRAKEE PRDHDVFLES LLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37243475878Probable WRKY transcription factor 4
2lex_A2e-37243475878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021279389.10.0WRKY transcription factor WRKY24 isoform X1
SwissprotQ6B6R41e-140WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBLA0A1Q3ASF00.0A0A1Q3ASF0_CEPFO; WRKY domain-containing protein
STRINGEOY346310.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-116WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]