PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1081_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 183aa    MW: 20789.5 Da    PI: 9.8365
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1081_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.81.5e-4361137278
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    Cqve+C adls+ak+yhrrhkvCevh+ka+vvlv+g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a
  Neem_1081_f_1  61 CQVENCMADLSDAKQYHRRHKVCEVHAKAQVVLVAGIRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKNAA 137
                    **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-3455122IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.7158135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-3960138IPR004333Transcription factor, SBP-box
PfamPF031103.0E-3361134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MDAKGKNKMV KVVKKEAAFA ESDDEDYDHC MQEDYSGSKK MKRIASQKGS SGASSGGLRN  60
CQVENCMADL SDAKQYHRRH KVCEVHAKAQ VVLVAGIRQR FCQQCSRFHE LSEFDETKRS  120
CRRRLAGHNE RRRKNAAESN GEGSNRKGMS TQLKDMVCGQ VDEKGRIKIA IQENATYKHF  180
QIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-4049134184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447265.17e-81hypothetical protein CICLE_v10016841mg
RefseqXP_006469892.17e-81PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ9S7A99e-49SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLV4U8P38e-81V4U8P3_9R
STRINGVIT_12s0028g03350.t019e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-49squamosa promoter binding protein-like 5