PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10694_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 189aa    MW: 21141.1 Da    PI: 9.1811
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10694_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.85.2e-221053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     ++++  rqvtfskRrng++KKA+EL +LC+a+va+++fs+ gk
  Neem_10694_f_2 10 MVKDSNSRQVTFSKRRNGLFKKANELATLCAAQVAIVVFSPGGK 53
                    5789999**********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.59161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.11E-28176IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-34160IPR002100Transcription factor, MADS-box
CDDcd002656.42E-34271No hitNo description
PRINTSPR004041.4E-20323IPR002100Transcription factor, MADS-box
PfamPF003196.9E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MGRRKIEMKM VKDSNSRQVT FSKRRNGLFK KANELATLCA AQVAIVVFSP GGKPFSFGHP  60
SVDSVAQRFL NQDSGKNPAE AYDHVDPRQQ ARVEKLSQQL TDLLQELHVE KKRGEALDKD  120
IKANAMFRNK KSINDLNLDE LLKMKASLEV LRENLKGLVN EMEASASLLL LKQGTGEDDD  180
DQQLGSCQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A1e-14186183MEF2 CHIMERA
6byy_B1e-14186183MEF2 CHIMERA
6byy_C1e-14186183MEF2 CHIMERA
6byy_D1e-14186183MEF2 CHIMERA
6bz1_A1e-14169169MEF2 CHIMERA
6bz1_B1e-14169169MEF2 CHIMERA
6bz1_C1e-14169169MEF2 CHIMERA
6bz1_D1e-14169169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006468192.26e-82agamous-like MADS-box protein AGL29
SwissprotO647034e-50AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBLA0A067GET85e-81A0A067GET8_CITSI; Uncharacterized protein
STRINGXP_006468192.19e-82(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-52AGAMOUS-like 29
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]