PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10694_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 219aa    MW: 24379.7 Da    PI: 8.9097
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10694_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.34.8e-191561147
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    krien+  r +tfskRr gi KKA+EL +L++aev v++fs++gk +
  Neem_10694_f_1 15 KRIENEDDRLITFSKRRSGIYKKASELVTLTGAEVGVVVFSPSGKPF 61
                    79******************************************955 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-29766IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.488767IPR002100Transcription factor, MADS-box
CDDcd002652.08E-33876No hitNo description
SuperFamilySSF554555.1E-26885IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-18929IPR002100Transcription factor, MADS-box
PfamPF003194.7E-231663IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-182944IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-184465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAEKKTKGRQ KIEMKRIENE DDRLITFSKR RSGIYKKASE LVTLTGAEVG VVVFSPSGKP  60
FSFGHPSIEA VANRFMGVHP PPNDNTHPLV EAHRQVRINE LNQLHNDLLR QLDAEKERGK  120
VLKQMTKGKE TQQGWWEAPI EELNLQQLLQ MNTSFDELHK ALLQKLNEKD PVGASSSVLP  180
TMNPGQAQAG AANPFAPNPD EFDPSGALPF SYGFKAGQL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006492961.11e-95agamous-like MADS-box protein AGL62
TrEMBLV4RKC32e-94V4RKC3_9ROSI; Uncharacterized protein
STRINGXP_006492961.14e-95(Citrus sinensis)
STRINGXP_006421343.14e-95(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.16e-41AGAMOUS-like 62