PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1067_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 220aa    MW: 23918.8 Da    PI: 8.3956
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1067_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.94.7e-4581071100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeAe+r+rdPvyG+vgvi+ lq++l+ql+ +l+ 
  Neem_1067_f_1   8 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELQPSQREDAVNSLAYEAEMRLRDPVYGCVGVISFLQHRLRQLQMDLSC 103
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +k+e
  Neem_1067_f_1 104 AKSE 107
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2487108IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-448105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MASSSNSPCA ACKFLRRKCQ PECVFAPYFP PDQPQKFANV HKVFGASNVT KLLNELQPSQ  60
REDAVNSLAY EAEMRLRDPV YGCVGVISFL QHRLRQLQMD LSCAKSELSK YQNLGITGHA  120
GLIAAAAAAA TASTTHHHQN MGINLIGGGS GGGGGRDHHF HHQFFPRDHH QQQMIRGFDG  180
SSNYDASLLA MNVSASIGQL SQFQQPRAAA GDDRRTIDPS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002266137.11e-124PREDICTED: LOB domain-containing protein 6
RefseqXP_010646844.11e-124PREDICTED: LOB domain-containing protein 6
RefseqXP_010646845.11e-124PREDICTED: LOB domain-containing protein 6
RefseqXP_010646846.11e-124PREDICTED: LOB domain-containing protein 6
SwissprotO044791e-93LBD6_ARATH; LOB domain-containing protein 6
TrEMBLD7SSJ31e-124D7SSJ3_VITVI; Putative uncharacterized protein
STRINGVIT_00s0340g00090.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126792531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-90LBD family protein