PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10634_f_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 814aa    MW: 88294.8 Da    PI: 4.9609
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10634_f_5genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.32.3e-16518556240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+CnCkkskClk+YCeCfaag++C e C+C+dC+Nk 
  Neem_10634_f_5 518 ACKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQDCFNKP 556
                     589**********************************96 PP

2TCR52.11.3e-16603642140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN+ 
  Neem_10634_f_5 603 RHKRGCNCKKSSCLKKYCECFQGGVGCSINCRCEGCKNTF 642
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.7E-18517558IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.173518643IPR005172CRC domain
PfamPF036381.1E-11520555IPR005172CRC domain
SMARTSM011145.0E-18603644IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.3E-12605641IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MDTPEKSSQI ATPLSKFETF EGVVDLGFLF VELGGFSENC CVSGCKIWKD SPVFNYINSL  60
SPIKPVKSLP VTQTFNSLNF ASLPSIFTSP HVSSHKETRF FRRNNCSDLS KPELSSENGN  120
KASTNDGIAA DASQLYDNSA DLQENFDPAV SIAEVPVEAS SDSKFAIELP RALKYDCGSP  180
GSEPAPCGIE RNCASELAST SAPVVPFVQE ASENVSSEGQ LHSQGMCQME QKKEMAGCDW  240
ESLISDAADL LIFNFPNDSE AFKGLIQKSL DPAASYTSVS PGFPQNNFSG EPRMQMIDPV  300
GSGQQHEMED PSTQPGESSI LNEINRAQDS PNDDLDECLT GDPSEKVGMN IPVSCKPISN  360
LHRGMLRRCL DFELVARRKN LDDGSNCSSS MILQSDDKIT TEDKQLVPLK PSSDSSRQIL  420
PGIGLHLNAL AISSQDNKNI RIDALSTGRY LSLPGSAASF NSSTTTEDPL HESLPSATNE  480
RDMVAVENGV SLAEDASQTS AYLAGEERRL ENSGEGDACK RCNCKKSKCL KLYCECFAAG  540
VYCIEPCSCQ DCFNKPIHED TVLATRKQIE SRNPLAFAPK VIRSADCLPE LGEDSSKTPA  600
SARHKRGCNC KKSSCLKKYC ECFQGGVGCS INCRCEGCKN TFGRKDGSAL TETEGEAEEE  660
EMETCEKSGV DKHLQKTEIP NSEEQNPSSA LPTTPLRLCR PLVQLPFSSK CKPPRSLLTI  720
GSSSGFYTGH KYGKPNILRS QPKFEKGLQT APEDEMPEIL RENSTPSSGI KTSSPNSKRV  780
SPPNTILGSS PSRRSGRKLI LQSIPSFPSL TPQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1652264014120Protein lin-54 homolog
5fd3_B2e-1652264014120Protein lin-54 homolog
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024046057.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A2H5Q1310.0A0A2H5Q131_CITUN; Uncharacterized protein
STRINGXP_006489438.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-156TESMIN/TSO1-like CXC 2