PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10270_a_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 72aa    MW: 8183.53 Da    PI: 10.7449
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10270_a_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.36.5e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gkl  y++
  Neem_10270_a_1  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLSQYAT 59
                    79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.777161IPR002100Transcription factor, MADS-box
CDDcd002656.48E-35261No hitNo description
SuperFamilySSF554551.57E-29264IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLSQYATD  60
SWYDLSINSI LS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-21159159MEF2C
5f28_B4e-21159159MEF2C
5f28_C4e-21159159MEF2C
5f28_D4e-21159159MEF2C
6byy_A5e-21159159MEF2 CHIMERA
6byy_B5e-21159159MEF2 CHIMERA
6byy_C5e-21159159MEF2 CHIMERA
6byy_D5e-21159159MEF2 CHIMERA
6bz1_A5e-21159159MEF2 CHIMERA
6bz1_B5e-21159159MEF2 CHIMERA
6bz1_C5e-21159159MEF2 CHIMERA
6bz1_D5e-21159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN2143491e-53JN214349.1 Litchi chinensis APETALA1 (AP1) mRNA, complete cds.
GenBankJQ0629781e-53JQ062978.1 Litchi chinensis APETALA1-like protein (AP1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027773500.12e-35agamous-like MADS-box protein AGL8 homolog isoform X3
SwissprotO223282e-34AGL8_SOLCO; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A438I3882e-36A0A438I388_VITVI; Agamous-like MADS-box protein AGL8
TrEMBLA0A438JYR52e-36A0A438JYR5_VITVI; Agamous-like MADS-box protein AGL8
STRINGXP_004172815.14e-37(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60910.14e-36AGAMOUS-like 8