PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10058_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family BES1
Protein Properties Length: 328aa    MW: 35262.1 Da    PI: 8.1512
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10058_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822218.12e-6721471150
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     ++++r+ptwkErEnnkrRERrRRaiaakiyaGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++++g sasas +ss+q
  Neem_10058_f_4   2 TSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVERMDIIGGSASASACSSYQ 96 
                     5899******************************************************************************************* PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsssl 150
                             +sp++sy++sp+sssfpsp+s+  + +a+     +sl+p+l++ls++sss+
  Neem_10058_f_4  97 --------QSPCASYNPSPASSSFPSPQSSHYTANANGssdaNSLIPWLKNLSSSSSSA 147
                     ........9******************9988776665567789*********9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.0E-683141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTSGTRMPTW KERENNKRRE RRRRAIAAKI YAGLRMYGNY KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPVERM DIIGGSASAS ACSSYQQSPC ASYNPSPASS SFPSPQSSHY  120
TANANGSSDA NSLIPWLKNL SSSSSSASSK NHPHHLYIHG GSISAPVTPP LSSPTCRTPR  180
TKNDWDETTA GSAWPAQHYP FLPSSTPPSP GRQVLPDSGW LAGIQIPQSG PSSPTFSLVS  240
RNPFGFREEV LSGGPSRMWT PGQSGTCSPA IPAGVDNTAD VPMSDCIAAE FAFGSNAAGL  300
VKPWEGERIH EECVSDDLEL TLGNSKTR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449559.10.0hypothetical protein CICLE_v10015910mg
RefseqXP_006467592.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
RefseqXP_006467593.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X2
SwissprotQ9ZV881e-140BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A067GE960.0A0A067GE96_CITSI; Uncharacterized protein
TrEMBLV4W9570.0V4W957_9R
STRINGPOPTR_0004s06100.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-116BES1/BZR1 homolog 4