PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy022042
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YA
Protein Properties Length: 376aa    MW: 41850.2 Da    PI: 9.2009
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59542657PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.93e-32173229158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVNaKQy++Il+RRq+Rak+e ekk+ +k rkpylheSRh hA+rR+Rg+gGrF
  Ahy022042 173 EEPVYVNAKQYHGILRRRQSRAKAELEKKV-IKVRKPYLHESRHLHAMRRARGNGGRF 229
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.3E-37171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.841172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-27174229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.1E-24175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.1E-24206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MPGKPESDEW RGGRSQQIQF QASIYAQPWW RGGAGENAPK SSSVDQQLNG SSAMNGGTIT  60
TQSETNEVVG FNKQMQSLIS QSLPGIDNSG GDVTKEHQNI KHAFSSTPFT MGKHLGPNSE  120
NESIGHSIVL TSQAYFDAHY GGGLTPYGQQ TMINPQLYGM NHARMLLPLE MEEEPVYVNA  180
KQYHGILRRR QSRAKAELEK KVIKVRKPYL HESRHLHAMR RARGNGGRFL NTKKLEGNNN  240
NSINPSMESG SSLSTATLHS NNDHYVVSQS MVHDMEKMQN FTIGFYGSNG LPQCTIHSLM  300
EEMRDIALVE KGKACLCMEP QMGLLNDISP QVGGSLQHMA TLKMKLVSFV SSNFGGDHRY  360
NREFHLRQLI LGSVKW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20173253275NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025615360.10.0nuclear transcription factor Y subunit A-1 isoform X1
RefseqXP_025615361.10.0nuclear transcription factor Y subunit A-1 isoform X1
RefseqXP_025615362.10.0nuclear transcription factor Y subunit A-1 isoform X1
TrEMBLA0A445BZV40.0A0A445BZV4_ARAHY; Uncharacterized protein
STRINGGLYMA12G36540.61e-112(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.38e-36nuclear factor Y, subunit A1