PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy021850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 337aa    MW: 37933.3 Da    PI: 7.1125
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59556084PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.11.2e-51141391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrF Ptdeel+v+yL++kv+g++++l  +i+e+d+yk++Pw Lp k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ +g++v
  Ahy021850  14 LPPGFRFYPTDEELLVQYLCRKVAGNHFSL-PIIAEIDLYKFDPWILPGKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKVITT-EGRKV 111
                79**************************99.88***************7767799*************************************99.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg+kt+W+mheyrl
  Ahy021850 112 GIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                **************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-6510164IPR003441NAC domain
PROSITE profilePS5100560.08914163IPR003441NAC domain
PfamPF023651.8E-2615139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGVPEKDPLS QLSLPPGFRF YPTDEELLVQ YLCRKVAGNH FSLPIIAEID LYKFDPWILP  60
GKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKVITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLL NGSQKSLGST KLDDWVLCRI YKKNLSSSQK VNMPSFTSKE  180
WSNGSSPSSS SHIDDMLELP EIDDRCFALP RVNSLQHEEK LTLGGTGNNF PDWVNSGGLD  240
SVPEFGSQSQ GMTSYDGNDL TYMSPPXSQF CHVNTMVVPG NPTEEEVQSG IRTQRIDENF  300
GLFQQNSNVF THRYLSSSGD SFGFGYPNQQ FGFGFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10311704171NO APICAL MERISTEM PROTEIN
1ut4_B1e-10311704171NO APICAL MERISTEM PROTEIN
1ut7_A1e-10311704171NO APICAL MERISTEM PROTEIN
1ut7_B1e-10311704171NO APICAL MERISTEM PROTEIN
4dul_A1e-10311704171NAC domain-containing protein 19
4dul_B1e-10311704171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016188607.10.0NAC domain-containing protein 72 isoform X2
RefseqXP_025643827.10.0NAC domain-containing protein 72 isoform X2
SwissprotA0A3Q7HH641e-130JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A445A3V90.0A0A445A3V9_ARAHY; Uncharacterized protein
STRINGGLYMA12G22880.11e-158(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-117NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]