PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy020949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 321aa    MW: 36307.7 Da    PI: 7.7433
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58473010PU_refUnigeneView CDS
PUT-171a-Arachis_hypogaea-26855PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM135.73e-42111341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhP+deelv++yL kk ++++  l   + +vd++k+ePwd+p+++  + kewyf+++rd+kyat    +++    + katgkd+++l+ kg+lv
  Ahy020949  11 LPPGFRFHPKDEELVCDYLMKKFTHNESLL---MIDVDLNKCEPWDIPETACVGGKEWYFYTQRDRKYATXAAYKQSNGIRILKATGKDRPILR-KGSLV 106
                79**********************999544...789************7777799**************99988888777789**********9.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g++ktLvfy+grapkg+kt+Wvmhe+r+
  Ahy020949 107 GMRKTLVFYQGRAPKGRKTEWVMHEFRV 134
                **************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-502158IPR003441NAC domain
PROSITE profilePS5100546.83711157IPR003441NAC domain
PfamPF023653.3E-2112134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MSNISLVEAR LPPGFRFHPK DEELVCDYLM KKFTHNESLL MIDVDLNKCE PWDIPETACV  60
GGKEWYFYTQ RDRKYATXAA YKQSNGIRIL KATGKDRPIL RKGSLVGMRK TLVFYQGRAP  120
KGRKTEWVMH EFRVEPPLPP PNTSSKEDWV LCRVFYKNRE VSGKPNSMGS CYDDTGSSSL  180
PALMDSFISF DQQQQPQTHL HADEYEQVPC FSIFSHTQTS PIFNHIMEPK LFPTNNNNNN  240
ATLYGGGGTT TTSNLGSCLD PFSCDRKVLK AVLSQLTNME RNIPNNNNNN TNSIKGSPSL  300
GEGSSESYLS EVGMPNLWNN Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-41615812166NO APICAL MERISTEM PROTEIN
1ut4_B1e-41615812166NO APICAL MERISTEM PROTEIN
1ut7_A1e-41615812166NO APICAL MERISTEM PROTEIN
1ut7_B1e-41615812166NO APICAL MERISTEM PROTEIN
4dul_A1e-41615812166NAC domain-containing protein 19
4dul_B1e-41615812166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171234.10.0NAC domain-containing protein 21/22
RefseqXP_025672523.10.0NAC domain-containing protein 21/22
SwissprotQ84TE61e-112NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A444Y2A10.0A0A444Y2A1_ARAHY; Uncharacterized protein
STRINGXP_007149262.11e-168(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-102NAC domain containing protein 1
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]