PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy020455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 150aa    MW: 17713.4 Da    PI: 10.0697
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59549959PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.81.7e-5631281128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+++yL +kv ++++++ ++i+evd++++ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke+++ +++lv
  Ahy020455   3 LPPGFRFHPTDEELISHYLYNKVIDTNFSA-RAIAEVDLNRSEPWDLPWKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIYR-GKSLV 100
                79**************************99.89***************888999****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kktLvfykgrapkgek+dWvmhe+rl
  Ahy020455 101 GMKKTLVFYKGRAPKGEKSDWVMHEFRL 128
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-632150IPR003441NAC domain
PROSITE profilePS5100558.4143150IPR003441NAC domain
PfamPF023651.7E-294128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MDLPPGFRFH PTDEELISHY LYNKVIDTNF SARAIAEVDL NRSEPWDLPW KAKMGEKEWY  60
FFCVRDRKYP TGLRTNRATE AGYWKATGKD KEIYRGKSLV GMKKTLVFYK GRAPKGEKSD  120
WVMHEFRLHG KFNPHNLPKS AKNEWVICRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-53115015162NO APICAL MERISTEM PROTEIN
1ut4_B1e-53115015162NO APICAL MERISTEM PROTEIN
1ut7_A1e-53115015162NO APICAL MERISTEM PROTEIN
1ut7_B1e-53115015162NO APICAL MERISTEM PROTEIN
3swm_A1e-53115018165NAC domain-containing protein 19
3swm_B1e-53115018165NAC domain-containing protein 19
3swm_C1e-53115018165NAC domain-containing protein 19
3swm_D1e-53115018165NAC domain-containing protein 19
3swp_A1e-53115018165NAC domain-containing protein 19
3swp_B1e-53115018165NAC domain-containing protein 19
3swp_C1e-53115018165NAC domain-containing protein 19
3swp_D1e-53115018165NAC domain-containing protein 19
4dul_A1e-53115015162NAC domain-containing protein 19
4dul_B1e-53115015162NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015937929.11e-111NAC domain-containing protein 100
RefseqXP_025616193.11e-111NAC domain-containing protein 100
SwissprotQ9FLJ21e-99NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A445C2C61e-109A0A445C2C6_ARAHY; Uncharacterized protein
STRINGGLYMA06G21020.11e-102(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-102NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]