PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy019711
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GeBP
Protein Properties Length: 175aa    MW: 19500.7 Da    PI: 9.732
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58474932PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57334.36.6e-113514897
     DUF573 48 kvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
               ++s +ql +Ki rLKkKf+++ +k ksgk  +  k+h+ ++f+l k +Wg
  Ahy019711  3 NASCNQLKDKIHRLKKKFENNLAKEKSGKG-TTLKPHELEAFQLGKNVWG 51
               67899*******************888887.6779**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.9E-11251IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
XSNASCNQLK DKIHRLKKKF ENNLAKEKSG KGTTLKPHEL EAFQLGKNVW GHDGRGGKTV  60
RNEASKKDKV NNEKAGESTP KKAVNSEPLD SRINELSGTS LALTSMLKYD GTFGKPFGED  120
YIRKGIELLG VSKREEIEAK WRKFEDAENK LYAEIAEFYA EQAKLLCQAN SSSSS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025605968.11e-124GLABROUS1 enhancer-binding protein-like
TrEMBLA0A445CTY41e-121A0A445CTY4_ARAHY; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.15e-10DNA-binding storekeeper protein-related transcriptional regulator