PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy016772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TCP
Protein Properties Length: 266aa    MW: 27816.1 Da    PI: 10.3894
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59520360PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP122.84e-3832124396
        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaak 96 
                +kk +++++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ ++s s+ +++ s ++ ++++a 
  Ahy016772  32 VKKPPSKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-SVSVSVRGGAGSLSSPSSTSAA 124
                79*****************************************************************9777.3333333333333333332222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.2093791IPR017887Transcription factor TCP subgroup
PfamPF036341.1E-3337192IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MSNTDGTSNA VTNIDTHRHH SQQQPTNGAL VVKKPPSKDR HSKVDGRGRR IRMPIICAAR  60
VFQLTRELGH KSDGQTIEWL LRQAEPSIIA ATGTGTTPAS FSSVSVSVRG GAGSLSSPSS  120
TSAASSLDHK PLLAPTPFIL GKRIRTDDDA SAKDDGVSVG PAVGSLVGPG APAGLWALPA  180
RPDFGQIWSF ATAAPPPEMV VQSAAVSVSQ QQQASLFVHH QHQQQQQAMG EASAARLGNY  240
LPGHLNLLAS LAGGPGNSGR RDDEPR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016176021.10.0transcription factor TCP7
RefseqXP_025674924.10.0transcription factor TCP7
SwissprotQ9FMX23e-94TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A445IU401e-125A0A445IU40_GLYSO; Transcription factor TCP7
TrEMBLI1LF871e-125I1LF87_SOYBN; Uncharacterized protein
STRINGGLYMA10G43190.11e-125(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.16e-64TCP family protein