PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy015859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YA
Protein Properties Length: 279aa    MW: 30683.6 Da    PI: 9.3557
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59514893PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA98.56.9e-31175231158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVN+KQy++Il+RRq Rakle+++kl ++ rkpylheSRh hAl+R+Rg gGrF
  Ahy015859 175 EEPIYVNSKQYHAILRRRQYRAKLEAHNKL-IRDRKPYLHESRHLHALKRARGAGGRF 231
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.6E-35173234IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.126174234IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.3E-26176231IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-23177199IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860179199IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.8E-23208231IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MKCMCEKESA LCSVHATPAY VLGCSSSWGN SPESDVVQQS SMSDKLNLNM GVVLPQQCHK  60
SRPLNLQFQE QDSSSTLSTN QSGQISIQHS NSSACSSSLS RNMEKSAGNQ ISSSMGILDF  120
SFPPSELDRG QSTAPIAFHC AYPCYGGILA AAYDQHSKVI GSAAVRIPLP LDLREEPIYV  180
NSKQYHAILR RRQYRAKLEA HNKLIRDRKP YLHESRHLHA LKRARGAGGR FLNTKNLVQS  240
KVTSTTTTSS YQAYIGRDIQ DYTADTGGAA SHRRLSVLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20175235262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025613723.10.0nuclear transcription factor Y subunit A-8 isoform X1
TrEMBLA0A444Y8P70.0A0A444Y8P7_ARAHY; Uncharacterized protein
STRINGXP_007135485.15e-86(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.42e-47nuclear factor Y, subunit A8