PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy012614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GeBP
Protein Properties Length: 427aa    MW: 46810.7 Da    PI: 4.5061
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59539661PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731201.2e-37113208297
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                lfqrlw++eDei lLqG++++++++g+s ++d+  fy+++k++++++++k+qlveKirrLKkK+++  +k+ sgke++f+++hdq +fe+s+kiW 
  Ahy012614 113 LFQRLWTDEDEIELLQGFLEYTSQRGSSHHNDTALFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVLNKIGSGKEFNFKSAHDQATFEISRKIWS 208
                79*********************************************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.8E-35114208IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MASEQHDTVF PEEDMDEDDE ESQEDEEEED IDDDDVLPDD EENEPSPSTS SAALAVTVAV  60
PSSVIPNGEK APISTPTANA ATTVVVALEG SSSDPKRQQQ IEEKKPLDDS RRLFQRLWTD  120
EDEIELLQGF LEYTSQRGSS HHNDTALFYD QIKSKLQLDF NKNQLVEKIR RLKKKYRNVL  180
NKIGSGKEFN FKSAHDQATF EISRKIWSNL GPVADNALDD DEINLNPIPN PNPNLNFTFA  240
LPAPRTETLF GNSSEKKTPP SRKRSRPRSS AATTVKIEER RESMDGSASH KEHNFNLNAA  300
ATGLPATPNN NCESNKCSGG YGIPGLVEET VRSCLSPLVK ELVGGAAMGG GHFGGRGFGG  360
GGFSLNPIPL GFGAMNNLGL GLGGGELVDE RWRKQQILEL EVYSKRLELV QEQIKAALEE  420
LRSTAGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1353361GGRGFGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015968523.10.0PREDICTED: mediator-associated protein 1
TrEMBLI1NC701e-153I1NC70_SOYBN; Uncharacterized protein
STRINGGLYMA19G43180.11e-153(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.13e-71DNA-binding storekeeper protein-related transcriptional regulator