PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy010678
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HB-other
Protein Properties Length: 141aa    MW: 15889.2 Da    PI: 8.2579
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59522459PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.4e-213994156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R++ k
  Ahy010678 39 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQVK 94
               678899**********************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-242394IPR009057Homeodomain-like
SuperFamilySSF466891.09E-202496IPR009057Homeodomain-like
PROSITE profilePS5007116.8113696IPR001356Homeobox domain
SMARTSM003891.2E-1837100IPR001356Homeobox domain
PfamPF000468.7E-193994IPR001356Homeobox domain
CDDcd000864.94E-153996No hitNo description
PRINTSPR000312.3E-56776IPR000047Helix-turn-helix motif
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PRINTSPR000312.3E-57692IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
XSATKSGSEN LEVEGGGGSG GGGEGGSAGE DQNPRPNKKK RYHRHTQHQI QEMEAFFKEC  60
PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQVKTQTERS ENSQLRAENE KLRADNMRLD  120
PHSSNSTLLL DRGCNLNMPS P
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015953298.17e-62PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein HDG2
RefseqXP_016188415.11e-61PREDICTED: homeobox-leucine zipper protein HDG2-like
SwissprotQ6ZAR07e-51ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLA0A0B2RPV62e-58A0A0B2RPV6_GLYSO; Homeobox-leucine zipper protein HDG2
TrEMBLA0A0B2SKN92e-58A0A0B2SKN9_GLYSO; Homeobox-leucine zipper protein HDG2
TrEMBLA0A0K2CTA44e-58A0A0K2CTA4_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLA0A0R0H7G53e-58A0A0R0H7G5_SOYBN; Uncharacterized protein
TrEMBLA0A0R0H7I03e-58A0A0R0H7I0_SOYBN; Uncharacterized protein
TrEMBLI1M4364e-58I1M436_SOYBN; Uncharacterized protein
TrEMBLK7LVW44e-58K7LVW4_SOYBN; Uncharacterized protein
TrEMBLK7LVW63e-58K7LVW6_SOYBN; Uncharacterized protein
STRINGGLYMA12G32050.21e-57(Glycine max)
STRINGGLYMA13G38430.11e-57(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.48e-46homeodomain GLABROUS 2