PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy010013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 306aa    MW: 34536.8 Da    PI: 7.08
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59542669PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.33.6e-50101381129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrF P+deelv +yL kk++++++    ++ e+d++++ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++vl+  ++e+
  Ahy010013  10 LPPGFRFYPSDEELVLHYLYKKITNEEVLK-GTLMEIDLHTCEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVLDPlTREV 108
                79************************9655.78***************88888999**************************************999999 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg++ktLvfyk+rap+g kt W+mhe+rle
  Ahy010013 109 VGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-608156IPR003441NAC domain
PROSITE profilePS5100557.85610156IPR003441NAC domain
PfamPF023655.2E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFYPSD EELVLHYLYK KITNEEVLKG TLMEIDLHTC EPWQLPEVAK  60
LNANEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV LDPLTREVVG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLETP HMPPKEDWVL CRVFHKGKTD NSAKLSPQFM YEATPSSLTL  180
ASSSSSPPTN QTNCNNLHVI GYNQLPNFSS SSSPMAIHHN HHHHHHQNQN GSSSLMNLLQ  240
FSTKENSTIT QLSPKGGGGG GGGDDGGYGF MWDMDLEENS FHDGGVIASN LNDMRFEVDN  300
NTMVML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-47915616165NO APICAL MERISTEM PROTEIN
1ut4_B4e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_A4e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_B4e-47915616165NO APICAL MERISTEM PROTEIN
4dul_A4e-47915616165NAC domain-containing protein 19
4dul_B4e-47915616165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016183051.10.0protein CUP-SHAPED COTYLEDON 3
RefseqXP_025632451.10.0protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A445EG490.0A0A445EG49_ARAHY; Uncharacterized protein
STRINGGLYMA13G18620.21e-162(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.18e-93NAC domain containing protein 74