PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy009687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YA
Protein Properties Length: 339aa    MW: 36806.2 Da    PI: 6.8841
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58473152PU_refUnigeneView CDS
PUT-171a-Arachis_hypogaea-2317PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.31.1e-32172228158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVNaKQyq+Il+RRq+Rak+e ekkl +ksrkpylheSRh+hA+rR+Rg+gGrF
  Ahy009687 172 QEPVYVNAKQYQGILRRRQARAKAELEKKL-IKSRKPYLHESRHQHAMRRARGTGGRF 228
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-36170231IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.727171231IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.2E-28173228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-24174196IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860176196IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-24205228IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MQSKSETANR LRSDPHSFQP SGVCSEPWWH GGGYSAIPQA MPGANASNSS SLECPNGESE  60
SNEEGQSLSN SGMNEEDDDA AKDSQPADPN QSGNYGQENQ GMQHSAPSMR EEGLAQAPQL  120
ELVGHSIACA TNPYQDPYYG GMMAAYGPQQ LGFAPFIGMP HARMPLPLEM AQEPVYVNAK  180
QYQGILRRRQ ARAKAELEKK LIKSRKPYLH ESRHQHAMRR ARGTGGRFAK KSEVEGSNKG  240
KEKDGSGPVL SSQSISSSGS EPLPCDSNQT WNSPNVQLNA RGSKVHDKYE NGSGSYHSHN  300
GLQSYHLHSG DRVDEGDCSG QQRGSITNEH ASARRLAIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A8e-19172228258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015972671.10.0nuclear transcription factor Y subunit A-1
RefseqXP_015972734.10.0nuclear transcription factor Y subunit A-1
RefseqXP_025690366.10.0nuclear transcription factor Y subunit A-1
RefseqXP_025690375.10.0nuclear transcription factor Y subunit A-1
SwissprotQ9LXV54e-90NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A445EW810.0A0A445EW81_ARAHY; Uncharacterized protein
STRINGGLYMA18G07890.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.42e-85nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]