PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy008969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 422aa    MW: 46452.9 Da    PI: 9.0497
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59524587PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.74.7e-53772041128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yLk+kv gk++++ ++i+evdiy++ePwdL   +++k++++ewyfFs  dkky +g r nrat++gyWkatg+d++v++ +++
  Ahy008969  77 LAPGFRFHPTDEELVIYYLKRKVCGKSFRF-DAISEVDIYRSEPWDLAdkSRLKTRDQEWYFFSALDKKYGNGGRMNRATSKGYWKATGNDRPVKH-EQR 174
                579**************************9.99**************75348899999**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +vglkktLvf++grap+g++t+Wvmheyrl
  Ahy008969 175 TVGLKKTLVFHSGRAPDGKRTNWVMHEYRL 204
                ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6167232IPR003441NAC domain
PROSITE profilePS5100558.12677231IPR003441NAC domain
PfamPF023651.6E-2779204IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRETLLHPP PPSTTTATAT HTPPPPPPLP SLPSLTQAGP SGGVSASAPS PSASPSSPAI  60
VATTAVATAV AAPPTSLAPG FRFHPTDEEL VIYYLKRKVC GKSFRFDAIS EVDIYRSEPW  120
DLADKSRLKT RDQEWYFFSA LDKKYGNGGR MNRATSKGYW KATGNDRPVK HEQRTVGLKK  180
TLVFHSGRAP DGKRTNWVMH EYRLVDEELE RARSGSSQPQ DAYVLCRVFH KNNIGPPNGQ  240
RYAPFVEEEW DDASALVPGA EPVEDVTVTV AHPLRIESNG RTLCSDRRNN VAQDTQSNNK  300
VPFDVNKLPI ETQSLLAVCK RESMAEFPSP EKEDNSKRQI DEYPLPQTEN TKPISQIYKR  360
RRHYLNVNHS NVNGDSVRTI QEPPCSSTIT TAATTLPTVA TTASTAITNV APKKHFLSAL  420
VX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-507623319170NAC domain-containing protein 19
3swm_B4e-507623319170NAC domain-containing protein 19
3swm_C4e-507623319170NAC domain-containing protein 19
3swm_D4e-507623319170NAC domain-containing protein 19
3swp_A4e-507623319170NAC domain-containing protein 19
3swp_B4e-507623319170NAC domain-containing protein 19
3swp_C4e-507623319170NAC domain-containing protein 19
3swp_D4e-507623319170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016175593.10.0uncharacterized protein LOC107618149 isoform X1
RefseqXP_025674693.10.0NAC domain containing protein 50 isoform X1
SwissprotQ9SQX91e-107NAC50_ARATH; NAC domain containing protein 50
TrEMBLA0A444XRL20.0A0A444XRL2_ARAHY; Uncharacterized protein
STRINGXP_004496131.10.0(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-101NAC domain containing protein 50
Publications ? help Back to Top
  1. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]