PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy008395
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 272aa    MW: 31619.1 Da    PI: 6.5725
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58459507PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.51.6e-50171451129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrF P+deelv++yL kk+++++l   +++ e+d++ +ePw+Lp+ +k + +ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v +  ++e+
  Ahy008395  17 LPPGFRFYPSDEELVCHYLYKKITNQQLLK-DTLIEIDLHICEPWQLPEVAKLNANEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVQDPlTQEV 115
                79*************************777.7899*************88888999*************************************9999999 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg++ktLvfy++rap+g kt W+mhe+rle
  Ahy008395 116 VGMRKTLVFYRNRAPNGIKTGWIMHEFRLE 145
                ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6113163IPR003441NAC domain
PROSITE profilePS5100557.47817163IPR003441NAC domain
PfamPF023656.7E-2818144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
XELIYIEMGL RDIGASLPPG FRFYPSDEEL VCHYLYKKIT NQQLLKDTLI EIDLHICEPW  60
QLPEVAKLNA NEWYFFSFRD RKYATGFRTN RATTSGYWKA TGKDRTVQDP LTQEVVGMRK  120
TLVFYRNRAP NGIKTGWIMH EFRLETPHMP PKEDWVLCRV FHKSKEENSG KLIMYDSIST  180
HHESSNSMAL VSTHLLNPIN NHNAMNNFLH HFSSSRDDSQ TNNANNNNNN NSPKGYDGYG  240
FIWDHMDLED HSVPLSDFQV DNNNNNNNIA LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-4881661171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025603229.10.0protein CUP-SHAPED COTYLEDON 3
SwissprotQ84TE68e-64NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A445CPS70.0A0A445CPS7_ARAHY; Uncharacterized protein
STRINGXP_007162552.11e-128(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-92NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]