PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy007586
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TCP
Protein Properties Length: 200aa    MW: 21083.6 Da    PI: 8.3519
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59551246PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP101.41.6e-3147128486
        TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                  ++++++hTkv+gR+RRvR++ +caar+F+L++eLG+ +d++tieWL+  a p+i+++tgt++ +a  +++++  +++s++s
  Ahy007586  47 SSRSNKDRHTKVNGRGRRVRMPPLCAARIFQLTRELGHRSDGETIEWLFS-ADPSIIAATGTGTVPAAPVSSSAAAVTSSAPS 128
                67899******************************************996.9**********888885552222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.4E-2750139IPR005333Transcription factor, TCP
PROSITE profilePS5136922.20951105IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MSSEIVLHQQ FSQSEPLPIS STVTTTTTTT GVALRKSSGA GALSTTSSRS NKDRHTKVNG  60
RGRRVRMPPL CAARIFQLTR ELGHRSDGET IEWLFSADPS IIAATGTGTV PAAPVSSSAA  120
AVTSSAPSVS CRVQPSASAT PTMVCAGGSQ WPSRRLDLCQ PPPGMEYASV NGHRYMPFTS  180
LLLQPATADE SQHEEALSDQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025635107.11e-118transcription factor TCP11-like
RefseqXP_025663894.11e-118transcription factor TCP11-like
SwissprotQ9SJK72e-36TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A394DAP52e-71A0A394DAP5_LUPAN; Uncharacterized protein
STRINGGLYMA13G20710.22e-65(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.19e-30TCP family protein