PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy002194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YA
Protein Properties Length: 206aa    MW: 22746.9 Da    PI: 6.6295
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S58468024PU_refUnigeneView CDS
PUT-171a-Arachis_hypogaea-2130895PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.61.6e-31111167158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep++VNaKQy++Il+RRq+Rak+e+e+k  +++rkpylheSRh hAl+R+Rg+gGrF
  Ahy002194 111 EEPVFVNAKQYHGILRRRQSRAKAESEHKA-IRNRKPYLHESRHLHALKRARGCGGRF 167
                69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.5E-35109170IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.959110170IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.0E-27112167IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.2E-23113135IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860115135IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.2E-23144167IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MTSANDITDN EADGKQQSES EMQSSSANGT SDPDTGSQNV QFEKPAQLGD VLAMAPPGYP  60
YPDPYYRSIF APYDTQAYAP QPYGYGGQPM VHFQLMGIQQ AGVPLPSDAF EEPVFVNAKQ  120
YHGILRRRQS RAKAESEHKA IRNRKPYLHE SRHLHALKRA RGCGGRFLNA KENENGHNDA  180
ASTDKSQCNI NPNSDKSDIT SSDRTV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-21110177168NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016189889.11e-154nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_016189890.11e-154nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_025638053.11e-154nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_029147541.11e-154nuclear transcription factor Y subunit A-7 isoform X1
SwissprotQ84JP13e-61NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A444ZXH91e-129A0A444ZXH9_ARAHY; Uncharacterized protein
STRINGGLYMA05G29970.14e-97(Glycine max)
STRINGXP_007159545.14e-97(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.25e-54nuclear factor Y, subunit A7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]